PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4890	EXPA4_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Cell wall; Membrane; Secreted; Signal | Expansin-A4 precursor (OsEXPA4) (Alpha-expansin-4) (OsEXP4),(OsaEXPa1.22).Secreted, cell wall; Peripheral membrane protein (By similarity)."	--NA--	CPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQMAIAGVLFLLFLARQASAAGYGGWQSAHATFYGGGDASGTMGGACGYGNLNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQFYSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNF	246	"Experimental evidence at transcript level"	25883.81	25867.26	8.17	--NA--	"FUNCTION:Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. Required for normal plant growth. May be required for rapid internodal elongation in deepwater rice during submergence.TISSUE SPECIFICITY:Expressed in lateral root primordia, adventitious root primordia, coleoptiles, shoot apex, leaf primordia, very young leaves, panicles and flowers.DEVELOPMENTAL STAGE:Expressed in the apical region (growing zone) of the root hair. Expressed in the basal growing zone of air-grown internode.INDUCTION:By gibberellin (GA3), submergence and wounding.MISCELLANEOUS:Plants lacking EXPA4 are smaller.SIMILARITY:Belongs to the expansin family. Expansin A subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. "