Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4795 |
| Peptide Name | NLTP1_TOBAC |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Nicotiana tabacum |
| Plant Source (Common Name) | Tobacco |
| Plant Family | Solanaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Lipid-binding; Pathogenesis-related protein; Plant defense; Signal; Transport | Non-specific lipid-transfer protein 1 precursor (LTP 1) (Pathogenesis-,related protein 14) (PR-14). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIMEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCPYKISPSTDCSKVQ |
| Sequence Length | 114 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 11523.59 |
| Monoisotopic Molecular Weight (Da) | 11515.76 |
| Isoelectric Point (pI) | 8.7 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q42952 |
| NCBI | --NA-- |
| EMBL | X62395 |
| Link to Source Databases | SPdb170381 |
|---|
| Addtional Information | FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. Binds cis-unsaturated fatty acids and jasmonic acid with a higher affinity than linear chain fatty acids. Formation of the complex with jasmonic acid results in a conformational change facilitating the LPT1 binding on the elicitin plasma membrane receptor that is known to be involved in plant defense induction. May also play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:High expression in leaf epidermis and shoot apex, and also in root epidermis during seedling germination.SIMILARITY:Belongs to the plant LTP family. |
