PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4795	NLTP1_TOBAC	--NA--	"Nicotiana tabacum"	Solanaceae	--NA--	Signaling-peptide	"3D-structure; Lipid-binding; Pathogenesis-related protein; Plant defense; Signal; Transport | Non-specific lipid-transfer protein 1 precursor (LTP 1) (Pathogenesis-,related protein 14) (PR-14)."	--NA--	CGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIMEIAGKIACFVVLCMVVAAPCAEAITCGQVTSNLAPCLAYLRNTGPLGRCPYKISPSTDCSKVQ	114	"Experimental evidence at protein level"	11523.59	11515.76	8.7	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. Binds cis-unsaturated fatty acids and jasmonic acid with a higher affinity than linear chain fatty acids. Formation of the complex with jasmonic acid results in a conformational change facilitating the LPT1 binding on the elicitin plasma membrane receptor that is known to be involved in plant defense induction. May also play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:High expression in leaf epidermis and shoot apex, and also in root epidermis during seedling germination.SIMILARITY:Belongs to the plant LTP family."