Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4758 |
| Peptide Name | ALEU_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Alternative splicing; Complete proteome; Glycoprotein; Hydrolase; Protease; Signal; Thiol protease; Vacuole; Zymogen | Thiol protease aleurain precursor (EC 3.4.22.16) (AtALEU) (Senescence-,associated gene product 2).Vacuole. Note=Predominantly vacuolar. From the Golgi apparatus, transported to t |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CASYPVVAGIVSPVKDQGGCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFGQSRHVLSFARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKLGAAQNCSATLKGSHKVTEAALPETKDWREDMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIATMSAKTILSSVVLVVLVAASAAANIGFDESNPIRMVSDGLREVEESVSQILNNYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKDETCKFSAENVGVQVLNSVNITLGAEDELKHAVGLVRPVSIAFEVIHSFRLYKSGVYTDSHCGSTP |
| Sequence Length | 358 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 38959.07 |
| Monoisotopic Molecular Weight (Da) | 38934.28 |
| Isoelectric Point (pI) | 6.28 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q8H166 |
| NCBI | --NA-- |
| EMBL | AF233883 |
| Link to Source Databases | SPdb7437 |
|---|
| Addtional Information | FUNCTION:May play a role in proteolysis leading to mobilization of nitrogen during senescence and starvation.CATALYTIC ACTIVITY:Hydrolysis of proteins, acting as an aminopeptidase (notably, cleaving Arg-|-Xaa bonds) as well as an endopeptidase.SUBUNIT:Interacts with VSR1/BP80B.INTERACTION:Q42403:TRX3; NbExp=1; IntAct=EBI-449450, EBI-449157;ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences; Name=1; IsoId=Q8H166-1; Sequence=Displayed;TISSUE SPECIFICITY:Expressed in leaves (at protein level).INDUCTION:Induced during senescence. Strongly induced by ethylene and slightly by abscisic acid. Repressed by cytokinin and darkness. Seems to be not affected by dehydration.SIMILARITY:Belongs to the peptidase C1 family. |
