Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4747 |
| Peptide Name | COBRA_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Complete proteome; Glycoprotein; GPI-anchor; Lipoprotein; Membrane; Signal | Protein COBRA precursor (Cell expansion protein).Lateral cell membrane; Lipid-anchor, GPI- anchor; Extracellular side (Probable). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | CACGCQNNRTESGACLDPDTPHLASVVSPPTKKGTVLPPLVQCTRHMCPIDPATAASSFQISVGAAGTTNKTVRVPRNFTLMGPGPGYTCGPAKIVRPTKDVMSWTPDGYVAVVTMFNFQKYRHIQSPGWTLGWKWAKKEVIWSMVGAQTFEKGWAFPRRIYFNGDNCVMPPPDSYPFLPNGGSRSQFSFVAAVLLPLLVFFFFSAFVTTDTRRTTQAMMTWNITCTYSQFLAQRTPTCCVSLSSFYNETIVGCPTMESFFSRSTSIVSKLSFLALWIVFLISSSSFTSTEAYDALDPEGNITMKWNYKSLTPYAGLNDTAMLWGVKFYNDFLSEAGPLGNVQSEILFRKDQSTFTRVHWHVKQNYKEYWRVKITITNFNYRLNYTQWNLVAQHPNLDNITQIFSFTEQGDCSKYKGNIPHCCKKDPTVVDLLPGTPYNQQIANCCKGGVMNSWVQ |
| Sequence Length | 456 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 51202.65 |
| Monoisotopic Molecular Weight (Da) | 51169.1 |
| Isoelectric Point (pI) | 8.93 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q94KT8 |
| NCBI | --NA-- |
| EMBL | AF319663 |
| Link to Source Databases | SPdb44416 |
|---|
| Addtional Information | FUNCTION:Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. May act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface.TISSUE SPECIFICITY:Expressed in roots, stems, leaves, flowers and siliques. Up-regulated in the root zone of rapid longitudinal expansion.MISCELLANEOUS:A partial protein missing the N-terminal signal peptide was reported to complement a yeast mutant defective in phytochelatin synthesis. It is therefore possible that COBRA binds divalent metals.SIMILARITY:Belongs to the COBRA family.SEQUENCE CAUTION:Sequence=BAB10641.1; Type=Erroneous gene model prediction; |
