Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4709
Peptide Name	ARS_CHLRE
PMID(s)	--NA--
Plant Source (Scientific Name)	Chlamydomonas reinhardtii
Plant Source (Common Name)	Algae
Plant Family	Chlamydomonadaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Calcium; Direct protein sequencing; Glycoprotein; Hydrolase; Metal-binding; Periplasm; Signal; Stress response | Arylsulfatase precursor (EC 3.1.6.1) (AS) (Aryl-sulfate,sulphohydrolase).Periplasm.
Activity Against	--NA--
IC50 value	--NA--
Sequence	AVSAELADGPAVFQAKVEEKSVPVPQDILKADVEKWFAFNNAEYYLAEQVVKTLDEAGVLDNTYIIYSADNGYHVGAHRFGAGKTTGYEEDLRVPFLGSXNKNLYEVDVSDKPAWIRALPLAQQNNRTYQEEIYRLRLRSLGPDELIIRGPGIKASKSDKPQNSKVGLHVDFAPTILSLAGASHLLGDKGLDGTPLGLLAVLAVCKGESCSNPWKILHPDGTVKNFTQALNSKYDRIYNAIRPFTYKLYANDDGTLPSDYPRPEQHRQQFQGEFWGGWSDELLQNLRSQPNNTWKVVMGALAVFAVACLAAVASVAHAADTKKPNFVVIFTDDQDAIQNSTHPHYMPMPXVTPYTFDYNTRLQRNGATPNIYPGEYSTDVIRDKGVAQIKSAVAAGKPFYAQISPIAPHTSTQISTNPATGVTRSYFFPPIPAPPHWQLFSDANLPGRCLPYLDWDNEDSQFKTQIRGANPAAGVGHHRLLTAASERAIATRRRAQARTYDESSKQGWKLIAQCTNERELYDLRKDPGELYNIYDKAKPAVRSRLEGSLHKYIRYPGVELSQYFVTTPVCCPSRTNLXRGQFAHNTNFTSVLPPYGGWAKWKGLGIDQSYLPLWLKDQGYNTYYVGKFLVDYSVSNYQQVPRAGTIS
Sequence Length	647
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	72105.84
Monoisotopic Molecular Weight (Da)	72061.12
Isoelectric Point (pI)	8.41
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4709

External links (Uniprot, PDB and Source Information Database)
Uniprot	P14217
NCBI	--NA--
EMBL	X16180
Link to Source Databases	SPdb16454
Addtional Information	CATALYTIC ACTIVITY:A phenol sulfate H(2)O = a phenol sulfate.COFACTOR:Binds 1 calcium ion per subunit (By similarity).INDUCTION:By sulfur deprivation.SIMILARITY:Belongs to the sulfatase family.SEQUENCE CAUTION:Sequence=CAA34302.1; Type=Frameshift; Positions=Several; Sequence=CAA36545.1; Type=Frameshift; Positions=Several;