Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4703 |
| Peptide Name | VPE_CITSI |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Citrus sinensis |
| Plant Source (Common Name) | Sweet orange |
| Plant Family | Rutaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Glycoprotein; Hydrolase; Protease; Signal; Thiol protease | Vacuolar-processing enzyme precursor (EC 3.4.22.-) (VPE). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AVNQRDADLLHFWDKYRKAPEGTPRKAEAQKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQACENIPSGPWSSLDKGFSALKKKHASGNYKSLVFYLEACESGSIFEGLLLEGLNIYATTASNAEESSWGMTRLASGVLITLLVALAGIADGSRDIAGDILKLPSEAYRFFHNGGGGAKVMYDDIAFNEENPRPGVIINHPHGDDVYKGVPKDYTGEDVTVEKFFAVVLGNDDDDSVGTRWAVLLAGSNGFWNYRHQADICHAYQLLRKGGLKDENIIVFNKTALTGGSGKVVDSGPNDHIFIFYSDHGGPGVLGMPTSRYIYADELIDVTASYNSYGSHVMQYGDIGLSKNNLFTYLGTNPANDNYTFVDENSLRPASKTYCPGEIPGPPPEYSTCLGDLYSIAWMEDSDIHNLRTETLHQQYELVKTR |
| Sequence Length | 494 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 54291.04 |
| Monoisotopic Molecular Weight (Da) | 54256.76 |
| Isoelectric Point (pI) | 5.58 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P49043 |
| NCBI | --NA-- |
| EMBL | Z47793 |
| Link to Source Databases | SPdb317834 |
|---|
| Addtional Information | FUNCTION:Asparagine-specific endopeptidase that may be involved in processing of proteins targeted to vacuoles that accumulate during ethylene-regulated processes such as flower opening and flavedo degreening.TISSUE SPECIFICITY:High levels are seen in the flowers, a lower level expression is seen in the leaves, while very low levels are seen in the stems and roots.DEVELOPMENTAL STAGE:The levels are low in green fruits but accumulate with color change occurring during ripening, reaching maximum levels in fully colored fruit. The levels increase during flower development and show highest levels in flowers at anthesis.SIMILARITY:Belongs to the peptidase C13 family. |
