Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4579
Peptide Name	WAKLK_ARATH
PMID(s)	--NA--
Plant Source (Scientific Name)	Arabidopsis thaliana
Plant Source (Common Name)	Mouse-ear cress
Plant Family	Brassicaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	ATP-binding; Complete proteome; Glycoprotein; Kinase; Membrane; Nucleotide-binding; Serine/threonine-protein kinase; Signal; Transferase; Transmembrane | Putative wall-associated receptor kinase-like 11 precursor,(EC 2.7.11.-).Membrane; Single-pass type I membrane protein (Potential).
Activity Against	--NA--
IC50 value	--NA--
Sequence	ARRCLNSKGKKRPCMRKVFTDLEKILASQEDSLVNIENDDGADDEEEGMTFSESRILGQGGQGTVYKGMLVDGRTVAVKKSKVVDEDKLEEFINEVVILSFSNASEPKRLFAKRYATVSLGWVIQTKNLSFVNSLSCKNTKEYDNSTYNIKGCYLNEWYKIECKNATYPFLFKMGMAVVNISLPGDDGYNNPVSYGSIRVKIPITSIGCSRDGKESGSVLNFTDSPFYFGIGNSLVAVGCNSKASLTNINKLVTSCICNNVTISGTDYANCGCSQGYEGNPYLPGGCKDINECLRNSYGQLKKRRMSKRKRKFFKRNGGLLLQQQLNTNKGNVEKTRIFSSRELEKATDNLRIAVDIAGALSYLHSAASSPIYHRDIKSTNILLDEKYRTKVSDFGTSRSMINIDDSQTIYVTAPAPSIVASSSSSDVQPLFPHPTWIMRCDNNYSFSILFSLLLILILDSKVVSLSTSCQSKSVCGNINIPYPFGIEPSKVGCELNCTASKETLPSKSIPFFDKTGCSNNKLPYYSSLCTKNNGEDEPVITVSNSQEIRGLADHFRVAMKENRFFEIMDARIRDGCKPEQVMAVANLQINHRHVVKLLGCCLETEVPTLVYEFIPNGNLFQHIHEESDDYTKTWGMRRQNCRESDTCVNLPGTFNCIGNKTRVTMIGVGSAFGILVLVVGIWWLRKFRSCDGNGCCIAGLLDSEAPQVIGINIESFDHGNSTKLECRVAFLTDDVSPVTIDHTHWTTVISGTVGYVDPEYYGSSQYTDKSDVYSFGVVLVELITGEK
Sequence Length	788
Validation	Protein inferred from homology
Average Molecular Weight (Da)	87391.38
Monoisotopic Molecular Weight (Da)	87335.5
Isoelectric Point (pI)	7.84
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4579

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q9LN59
NCBI	--NA--
EMBL	AE005172
Link to Source Databases	SPdb318950
Addtional Information	FUNCTION:Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.CATALYTIC ACTIVITY:ATP a protein = ADP a phosphoprotein.DOMAIN:The EGF-like region is specific to this family of proteins and seems to consist of the C-terminal of an EGF-like domain fused to the N-terminal of another one.SIMILARITY:Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.SIMILARITY:Contains 1 protein kinase domain.SEQUENCE CAUTION:Sequence=AAF79451.1; Type=Erroneous gene model prediction;