Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4503 |
| Peptide Name | SRF4_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | ATP-binding; Complete proteome; Glycoprotein; Leucine-rich repeat; Membrane; Nucleotide-binding; Receptor; Repeat; Signal; Transmembrane | Protein STRUBBELIG-RECEPTOR FAMILY 4 precursor (Leucine-rich repeat,receptor kinase-like protein SRF4).Membrane; Single-pass membrane protein (Potential). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | APESVSSFADIVSICVMTEPGLRPPVSNVVEALKRLVDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLETGGNKWSSGRAFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILGKGNPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRKAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGRKFAVKEIDSSLLLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGMGPNLQRIVLVFIACFGIFTSVVLAKTDSQDVSALNDAYKSMNSPSKLKGNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQPSPPPGTRHIDRNSSGGGGGSSKALTLGVIIAVSSIGGLILFAGLIALISRRKNSNDSSHFFDDEKGTNRSKPLFTPQSSQMLQFDNMEEFKNQKTVDSNTSLETKPSVKRTSSVSFKNSPTFHLIPSTQVAATPDRSSTSQDSPDTRGVVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYL |
| Sequence Length | 687 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 74911.4 |
| Monoisotopic Molecular Weight (Da) | 74864.74 |
| Isoelectric Point (pI) | 7.69 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q6R2K2 |
| NCBI | --NA-- |
| EMBL | AY518289 |
| Link to Source Databases | SPdb275504 |
| Addtional Information | FUNCTION:Acts as a direct positive regulator of leaf size but not leaf shape.TISSUE SPECIFICITY:Expressed in seedlings, roots, stems, leaves, flowers and siliques.DOMAIN:The protein kinase domain is predicted to be catalytically inactive.MISCELLANEOUS:Cannot functionally replace STRUBBELIG.MISCELLANEOUS:Over-expression of SRF4 led to an increased leaf surface and to male-sterility in both cv. Landsberg and cv.Columbia.MISCELLANEOUS:Loss-of-function mutants (T-DNA insertion) show a reduction in leaf size, but no apparent defect in pollen development or fertility.SIMILARITY:Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.SIMILARITY:Contains 5 LRR (leucine-rich) repeats.SIMILARITY:Contains 1 protein kinase domain.SEQUENCE CAUTION:Sequence=BAB01397.1; Type=Erroneous gene model prediction; |