Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4472 |
| Peptide Name | CLV3_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Alternative splicing; Complete proteome; Developmental protein; Differentiation; Hydroxylation; Secreted; Signal | Protein CLAVATA 3 precursor [Contains: MCLV3].Secreted, extracellular space (Probable). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | ANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLPMDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVG |
| Sequence Length | 96 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 10870.58 |
| Monoisotopic Molecular Weight (Da) | 10863.47 |
| Isoelectric Point (pI) | 7.27 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9XF04 |
| NCBI | --NA-- |
| EMBL | AF126009 |
| Link to Source Databases | SPdb41749 |
|---|
| Addtional Information | FUNCTION:Acts with CLV1 to control the balance between meristem cell proliferation and differentiation. May act with CLV1 as a ligand-receptor pair in a signal transduction pathway, coordinating growth between adjacent meristematic regions.FUNCTION:The secreted peptide MCLV3 activates a signal transduction cascade to restrict WUSCHEL (WUS) expression, inducing shoot and root meristem consumption as cells differentiated into other organs.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9XF04-1; Sequence=Displayed; Note=No experimental confirmation available; Name=2; IsoId=Q9XF04-2; Sequence=VSP_016629; Note=May be due to intron retention. No experimental confirmation available; Name=3; IsoId=Q9XF04-3; Sequence=VSP_016629, VSP_016630; Note=May be due to introns retention. No experimental confirmation available;TISSUE SPECIFICITY:First detected in heart stage embryos in a patch of cells between the developing cotyledons. In vegetative and inflorescence meristems, expressed in a small cone of cells at the meristem apex.PTM:The MCLV3 peptide contains two hydroxprolines, but hydroxylation had no direct effect on MCLV3 activity.MASS SPECTROMETRY:Mass=1345.6; Method=MALDI; Range=70-81; Note=MCLV3 with hydroxyPro-73 and hydroxyPro-76; Source=PubMed:16902141;MISCELLANEOUS:His-81 seems to be essential for the activity of MCLV3.SEQUENCE CAUTION:Sequence=AAD42004.1; Type=Erroneous gene model prediction; |
