PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4472	CLV3_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Alternative splicing; Complete proteome; Developmental protein; Differentiation; Hydroxylation; Secreted; Signal | Protein CLAVATA 3 precursor [Contains: MCLV3].Secreted, extracellular space (Probable)."	--NA--	ANGEAEKAKTKGLGLHEELRTVPSGPDPLHHHVNPPRQPRNNFQLPMDSKSFLLLLLLFCFLFLHDASDLTQAHAHVQGLSNRKMMMMKMESEWVG	96	"Experimental evidence at protein level"	10870.58	10863.47	7.27	--NA--	"FUNCTION:Acts with CLV1 to control the balance between meristem cell proliferation and differentiation. May act with CLV1 as a ligand-receptor pair in a signal transduction pathway, coordinating growth between adjacent meristematic regions.FUNCTION:The secreted peptide MCLV3 activates a signal transduction cascade to restrict WUSCHEL (WUS) expression, inducing shoot and root meristem consumption as cells differentiated into other organs.ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9XF04-1; Sequence=Displayed; Note=No experimental confirmation available; Name=2; IsoId=Q9XF04-2; Sequence=VSP_016629; Note=May be due to intron retention. No experimental confirmation available; Name=3; IsoId=Q9XF04-3; Sequence=VSP_016629, VSP_016630; Note=May be due to introns retention. No experimental confirmation available;TISSUE SPECIFICITY:First detected in heart stage embryos in a patch of cells between the developing cotyledons. In vegetative and inflorescence meristems, expressed in a small cone of cells at the meristem apex.PTM:The MCLV3 peptide contains two hydroxprolines, but hydroxylation had no direct effect on MCLV3 activity.MASS SPECTROMETRY:Mass=1345.6; Method=MALDI; Range=70-81; Note=MCLV3 with hydroxyPro-73 and hydroxyPro-76; Source=PubMed:16902141;MISCELLANEOUS:His-81 seems to be essential for the activity of MCLV3.SEQUENCE CAUTION:Sequence=AAD42004.1; Type=Erroneous gene model prediction; "