Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_4451 |
| Peptide Name | FUCO1_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Apoplast; Complete proteome; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal | Alpha-L-fucosidase 1 precursor (EC 3.2.1.51) (Alpha-L-fucoside,fucohydrolase) (Alpha-1,3/4-fucosidase) (AtFUC1).Secreted, extracellular space, apoplast. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AMFLHFGPNTFTDSEWGTGKANPSIFNPTHLNASQWVQIAKDSGFSRVILDIYYNSVGRNCLFLLNVPPNSSGLISEQDIKVLEEFSEMKNSIFSNNLARKAFVNSSSIRGDQSSQFGPKNVLEEGLDKYWAPEENQNEWVLYLEFKDLVLSPWDRHEQCYGKTLEYNEFYLSQMTELLTKYGEIKEVWLDGAKGDGEKDMEYFFDTWFSLIHQLQPKAVIFSDAGPDVRWIGDEAGLAGSTCWSLFNRTMNSQITLFFFFFSILSLSQISNSSSLLKPHPCPILPLPSSQQLQWQLGSMNAKIGDTEPSYSQEGDGYGQDWVPAECDVSIRPGWFWHASESPKPAVQLLNVVESRSLKLVVDKARTDPLISYLGLYMDKFSGSSRNTTKITITRTLKEEQQLHDLSFNVLEIREPIHMGQRIASFHLETRKTGSGEWERVVSGTTVGNKRLLRFLTAKHHDGFCLWPSEYTDYSVKSSQWRNGAGDVVAGLASAAKEAGIGLGLY |
| Sequence Length | 506 |
| Validation | Predicted |
| Average Molecular Weight (Da) | 57114.3 |
| Monoisotopic Molecular Weight (Da) | 57078.37 |
| Isoelectric Point (pI) | 5.35 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | Q8GW72 |
| NCBI | --NA-- |
| EMBL | AC005851 |
| Link to Source Databases | SPdb88235 |
| Addtional Information | FUNCTION:Hydrolyzes both 3- and 4-linked fucoses in Lewis determinants. Not active on neither 2-linked fucose nor on fucose in alpha-1,3-linkage to the innermost GlcNAc.CATALYTIC ACTIVITY:An alpha-L-fucoside H(2)O = L-fucose an alcohol.BIOPHYSICOCHEMICAL PROPERTIES:Kinetic parameters: KM=28 uM for lacto-N-fucopentaose II; KM=6.2 uM for 3-fucosyllactose; pH dependence: Optimum pH is 5. Activity decreases sharply toward pH 7;SIMILARITY:Belongs to the glycosyl hydrolase 29 family.CAUTION:Was reported by PubMed:11788770 to be an alpha-1,2- fucosidase.SEQUENCE CAUTION:Sequence=AAC98456.1; Type=Erroneous gene model prediction; |