Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4278 |
| Peptide Name | SCA_LILLO |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Lilium longiflorum |
| Plant Source (Common Name) | Trumpet lily |
| Plant Family | Liliaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Lipid-binding; Membrane; Signal; Transport | Stigma/stylar cysteine-rich adhesin precursor (Lipid transfer,protein).Membrane; Single-pass type I membrane protein (Potential). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGLNAAIVAGIPGKCGVNIPMARSSAVCFLLLLAFLIGTASAITCGQVDSDLTSCLGYARKGGVIPPGCCYPIRMQTDCNKVR |
| Sequence Length | 113 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 11685.79 |
| Monoisotopic Molecular Weight (Da) | 11677.99 |
| Isoelectric Point (pI) | 9.13 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9SW93 |
| NCBI | --NA-- |
| EMBL | AF171094 |
| Link to Source Databases | SPdb266179 |
|---|
| Addtional Information | FUNCTION:Acts as an adhesive agent between the pollen tube wall and the stylar transmitting tract epidermis. Binds a stylar pectin in a pH-dependent manner. Enhances activity of chemocyanin, a diffusible chemotropic factor.TISSUE SPECIFICITY:Highly expressed in style and stigma, abundant in young leaves and petals, and low expression in young anthers at pollen mother cell stage with an active tapetum. Not expressed in mature leaves or in pollen grains or tubes. Found in the stylar transmitting tract epidermis and in the stylar extracellular matrix.DEVELOPMENTAL STAGE:Expressed throughout development of the stigma and style, and then decreases at 6 days after anthesis.SIMILARITY:Belongs to the plant LTP family. |
