PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4278	SCA_LILLO	--NA--	"Lilium longiflorum"	Liliaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Lipid-binding; Membrane; Signal; Transport | Stigma/stylar cysteine-rich adhesin precursor (Lipid transfer,protein).Membrane; Single-pass type I membrane protein (Potential)."	--NA--	AGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGLNAAIVAGIPGKCGVNIPMARSSAVCFLLLLAFLIGTASAITCGQVDSDLTSCLGYARKGGVIPPGCCYPIRMQTDCNKVR	113	"Experimental evidence at protein level"	11685.79	11677.99	9.13	--NA--	"FUNCTION:Acts as an adhesive agent between the pollen tube wall and the stylar transmitting tract epidermis. Binds a stylar pectin in a pH-dependent manner. Enhances activity of chemocyanin, a diffusible chemotropic factor.TISSUE SPECIFICITY:Highly expressed in style and stigma, abundant in young leaves and petals, and low expression in young anthers at pollen mother cell stage with an active tapetum. Not expressed in mature leaves or in pollen grains or tubes. Found in the stylar transmitting tract epidermis and in the stylar extracellular matrix.DEVELOPMENTAL STAGE:Expressed throughout development of the stigma and style, and then decreases at 6 days after anthesis.SIMILARITY:Belongs to the plant LTP family."