Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4263 |
| Peptide Name | CHIC_SECCE |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Secale cereale |
| Plant Source (Common Name) | Rye |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Antimicrobial; Carbohydrate metabolism; Chitin degradation; Chitin-binding; Direct protein sequencing; Fungicide; Glycosidase; Hydrolase; Plant defense; Polysaccharide degradation; Signal | Basic endochitinase C precursor (EC 3.2.1.14) (Rye seed chitinase-c),(RSC-c). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPMRSLAVVVAVVATVAMAIGTAHGSVSSIISHAQFDRMLLHRNDGACQAKGPSGADRAAGRAPGFGVITNIINGGLECGHGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQRPFA |
| Sequence Length | 266 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 28301.82 |
| Monoisotopic Molecular Weight (Da) | 28283.82 |
| Isoelectric Point (pI) | 8.82 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q9FRV0 |
| NCBI | --NA-- |
| EMBL | AB051579 |
| Link to Source Databases | SPdb37856 |
|---|
| Addtional Information | FUNCTION:Defense against chitin containing fungal pathogens.Binds the hyphal tips of fungi and degrades nascent chitin.CATALYTIC ACTIVITY:Random hydrolysis of N-acetyl-beta-D- glucosaminide 1,4-beta-linkages in chitin and chitodextrins.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is about 5.0. Stable between pH 4 and pH 8; Temperature dependence: Enzyme activity is retained almost fully under 40 degrees Celsius and completely destroyed at 70 degrees Celsius. At 60 degrees Celsius the activity was 15-30% compared to the untreated enzyme;TISSUE SPECIFICITY:Localized to the starchy endoderm of the seed May localize to other parts of the seed including the aleurone cells (at protein level).DEVELOPMENTAL STAGE:Levels increase from 23 to 40 days after flowering, and are maintained until maturation (at protein level).SIMILARITY:Belongs to the glycosyl hydrolase 19 family. Chitinase class II subfamily. |
