PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4263	CHIC_SECCE	--NA--	"Secale cereale"	Poaceae	--NA--	Signaling-peptide	"Antimicrobial; Carbohydrate metabolism; Chitin degradation; Chitin-binding; Direct protein sequencing; Fungicide; Glycosidase; Hydrolase; Plant defense; Polysaccharide degradation; Signal | Basic endochitinase C precursor (EC 3.2.1.14) (Rye seed chitinase-c),(RSC-c)."	--NA--	AGRAIGVDLLRNPDLVATDPTVSFKTALWFWMTAQAPKPSSHAVITGKWSFYTYDAFVAAANAFPGFGATGSTDARKRDVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGAAADYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPMRSLAVVVAVVATVAMAIGTAHGSVSSIISHAQFDRMLLHRNDGACQAKGPSGADRAAGRAPGFGVITNIINGGLECGHGQDSRVADRIGFYKRYCDILGVGYGDNLDCYNQRPFA	266	"Experimental evidence at protein level"	28301.82	28283.82	8.82	--NA--	"FUNCTION:Defense against chitin containing fungal pathogens.Binds the hyphal tips of fungi and degrades nascent chitin.CATALYTIC ACTIVITY:Random hydrolysis of N-acetyl-beta-D- glucosaminide 1,4-beta-linkages in chitin and chitodextrins.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is about 5.0. Stable between pH 4 and pH 8; Temperature dependence: Enzyme activity is retained almost fully under 40 degrees Celsius and completely destroyed at 70 degrees Celsius. At 60 degrees Celsius the activity was 15-30% compared to the untreated enzyme;TISSUE SPECIFICITY:Localized to the starchy endoderm of the seed May localize to other parts of the seed including the aleurone cells (at protein level).DEVELOPMENTAL STAGE:Levels increase from 23 to 40 days after flowering, and are maintained until maturation (at protein level).SIMILARITY:Belongs to the glycosyl hydrolase 19 family. Chitinase class II subfamily."
