Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4216 |
| Peptide Name | KAB2_OLDAF |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Oldenlandia affinis |
| Plant Source (Common Name) | Blue Diamond Flower |
| Plant Family | Rubiaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | 3D-structure; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Oxidation; Plant defense; Repeat; Signal | Kalata-B2 precursor. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AGGKTSETTLHMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPICTRDSLPMSAGGKTSETTLHMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPICMAKFTNCLVLSLLLAAFVGAFGAEFSEADKATLVNDIAENIQKEILGEVKTRDSLPLVAATSETVLTMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPICTRDSLPMR |
| Sequence Length | 210 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 22327.09 |
| Monoisotopic Molecular Weight (Da) | 22311.58 |
| Isoelectric Point (pI) | 5.45 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P58454 |
| NCBI | --NA-- |
| EMBL | AF393828 |
| Link to Source Databases | SPdb129827 |
|---|
| Addtional Information | FUNCTION:Probably participates in a plant defense mechanism.Inhibitory effect on the growth and development of larvae from Helicoverpa punctigera. Has hemolytic activity.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:Kalata-B2 is a cyclic peptide which occurs in three forms: with unmodified Trp, with Trp oxidized to form N-formylkynurenine and with Trp oxidized to form kynurenine. Oxidation is enhanced by exposure to sunlight.MASS SPECTROMETRY:Mass=2955.4; Method=Electrospray; Range=67-95; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2987.4; Method=Electrospray; Range=67-95; Note=With N-formylkynurenine; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2959.4; Method=Electrospray; Range=67-95; Note=With kynurenine; Source=PubMed:17534989;SIMILARITY:Belongs to the cyclotide family. Moebius subfamily. |
