PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4216	KAB2_OLDAF	--NA--	"Oldenlandia affinis"	Rubiaceae	--NA--	Signaling-peptide	"3D-structure; Cytolysis; Direct protein sequencing; Hemolysis; Knottin; Oxidation; Plant defense; Repeat; Signal | Kalata-B2 precursor."	--NA--	AGGKTSETTLHMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPICTRDSLPMSAGGKTSETTLHMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPICMAKFTNCLVLSLLLAAFVGAFGAEFSEADKATLVNDIAENIQKEILGEVKTRDSLPLVAATSETVLTMFLKEMQLKGLPVCGETCFGGTCNTPGCSCTWPICTRDSLPMR	210	"Experimental evidence at protein level"	22327.09	22311.58	5.45	--NA--	"FUNCTION:Probably participates in a plant defense mechanism.Inhibitory effect on the growth and development of larvae from Helicoverpa punctigera. Has hemolytic activity.DOMAIN:The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.PTM:Kalata-B2 is a cyclic peptide which occurs in three forms: with unmodified Trp, with Trp oxidized to form N-formylkynurenine and with Trp oxidized to form kynurenine. Oxidation is enhanced by exposure to sunlight.MASS SPECTROMETRY:Mass=2955.4; Method=Electrospray; Range=67-95; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2987.4; Method=Electrospray; Range=67-95; Note=With N-formylkynurenine; Source=PubMed:17534989;MASS SPECTROMETRY:Mass=2959.4; Method=Electrospray; Range=67-95; Note=With kynurenine; Source=PubMed:17534989;SIMILARITY:Belongs to the cyclotide family. Moebius subfamily."