Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4185 |
| Peptide Name | ATL3B_ARATH |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis thaliana |
| Plant Source (Common Name) | Mouse-ear cress |
| Plant Family | Brassicaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Complete proteome; Membrane; Metal-binding; Phosphoprotein; Plant defense; Signal; Transmembrane; Ubl conjugation pathway; Zinc; Zinc-finger | RING-H2 finger protein ATL3B precursor (RING-H2 finger protein ATL6). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AFLRNASFLWRNSSVHVPRGGVNKDGEGTSVKSTGASGSTSGSVRLPVCTERFTLRLPEDVRKRIMKDWKLNRTNSLLVLPRGGSSRRGKPIDRSRARDVSVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWLEAHVTCPVCRANLAEQVAEGESVEPGGTEPDLELQQVVVNMRSSDHMAFAGVLPIVFLLILSSADLAASQSQPGPTNQPYNYGRLSPAMAPEPVVTAPVPEQLVTSEVDSRRLPGVPVDLKRVKFSRSHTTGHSVVQPGESDRWLFRKTPSFLWRSRDDGSIRLGATGSVRASAVPNSTGSDSVRAGDRWVIVVILIAALFFMGFFSIYFRHCSGVPDAGVSPAGGARSRATVNAAARGL |
| Sequence Length | 398 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 43274.2 |
| Monoisotopic Molecular Weight (Da) | 43247.19 |
| Isoelectric Point (pI) | 9.06 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q8RXX9 |
| NCBI | --NA-- |
| EMBL | AF132016 |
| Link to Source Databases | SPdb19418 |
|---|
| Addtional Information | FUNCTION:May be involved in the early steps of the plant defense signaling pathway (By similarity).PATHWAY:Protein degradation; protein ubiquitination.INDUCTION:By chitin or cellulases elicitors.DOMAIN:The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme (By similarity).PTM:Phosphorylation level varies significantly during early response to general elicitors.SIMILARITY:Belongs to the RING-type zinc finger family. ATL subfamily.SIMILARITY:Contains 1 RING-type zinc finger. |
