Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_4088
Peptide Name	CHI2_ORYSJ
PMID(s)	--NA--
Plant Source (Scientific Name)	Oryza sativa subsp. Japonica
Plant Source (Common Name)	Rice
Plant Family	Poaceae
Peptide Family	--NA--
Peptide Function	Signaling-peptide
Peptide Function Description	Carbohydrate metabolism; Chitin degradation; Chitin-binding; Glycosidase; Hydrolase; Polysaccharide degradation; Signal | Basic endochitinase 2 precursor (EC 3.2.1.14).
Activity Against	--NA--
IC50 value	--NA--
Sequence	ACPASNFYTYDAFVAAASAFPGFAAAGGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWGYCFKEENGGAAGPDYCQQSAQWPCAAGKKYYGRGPIQHAVATGQWTPSADDQAAGRVPGYGVITNIINGGLECGHGEDDRVADRIGFLSYNFNYGPAGQAIGADLLGDPDLVASDATVSFDTAFWFWMTPQSPKPSCMRALAVVAMVATAFLAAAVHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAGCQSQCSAAGCGGGGPTPPSGSGGSGVASIVSRSLFDQMLLHRNDAYKRYCDILGVSYDANLDCYSQRPFGS
Sequence Length	326
Validation	Experimental evidence at transcript level
Average Molecular Weight (Da)	33636.17
Monoisotopic Molecular Weight (Da)	33614.27
Isoelectric Point (pI)	4.63
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_4088

External links (Uniprot, PDB and Source Information Database)
Uniprot	P25765
NCBI	--NA--
EMBL	AC137992
Link to Source Databases	SPdb37803
Addtional Information	FUNCTION:Defense against chitin containing fungal pathogens.CATALYTIC ACTIVITY:Random hydrolysis of N-acetyl-beta-D- glucosaminide 1,4-beta-linkages in chitin and chitodextrins.SIMILARITY:Belongs to the glycosyl hydrolase 19 family. Chitinase class I subfamily.SIMILARITY:Contains 1 chitin-binding type-1 domain.SEQUENCE CAUTION:Sequence=Ref.1; Type=Frameshift; Positions=Several; Sequence=Ref.1; Type=Miscellaneous discrepancy; Note=Sequencing errors;