Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4062 |
| Peptide Name | LEC_ULVPE |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Ulva pertusa |
| Plant Source (Common Name) | Sea lettuce |
| Plant Family | Ulvaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Direct protein sequencing; Hemagglutinin; Lectin; Signal | Lectin precursor. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AATSDELQKTVVFLFVVEDDGLLLQAVKNNAHYPVTNGMYLASHRYYPKDEVGGGITNTDNWETFAGLPLTGAIKVNDGNSVVHISAYFPEDRRGKYSYYMINILHVIAGLALASVGVDARQVGVGADVLHAVENTIDSITGVEASHSALRPGSKYEGMVRLMVHADPAKAVIWEFVTVGGKQYLKVKENRDYTALQIPRHHP |
| Sequence Length | 203 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 22195.16 |
| Monoisotopic Molecular Weight (Da) | 22181.35 |
| Isoelectric Point (pI) | 6.13 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q6T6H8 |
| NCBI | --NA-- |
| EMBL | AY433960 |
| Link to Source Databases | SPdb137622 |
|---|
| Addtional Information | FUNCTION:N-acetyl-D-glucosamine-specific lectin. Specifically agglutinates rabbit erythrocytes.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is 6.0-8.0. No activity below pH 3.0 or above pH 11.0; Temperature dependence: Thermostable. Activity unaffected after incubation for 30 minutes at 30-70 degrees Celsius. Retains 50% of its maximal activity after incubation at 80 degrees Celsius for 30 minutes;SUBUNIT:Monomer.MISCELLANEOUS:Divalent cations are required for ligand binding.Calcium is the most effective, but manganese or zinc can also be used to a lesser extent. |
