PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4062	LEC_ULVPE	--NA--	"Ulva pertusa"	Ulvaceae	--NA--	Signaling-peptide	"Direct protein sequencing; Hemagglutinin; Lectin; Signal | Lectin precursor."	--NA--	AATSDELQKTVVFLFVVEDDGLLLQAVKNNAHYPVTNGMYLASHRYYPKDEVGGGITNTDNWETFAGLPLTGAIKVNDGNSVVHISAYFPEDRRGKYSYYMINILHVIAGLALASVGVDARQVGVGADVLHAVENTIDSITGVEASHSALRPGSKYEGMVRLMVHADPAKAVIWEFVTVGGKQYLKVKENRDYTALQIPRHHP	203	"Experimental evidence at protein level"	22195.16	22181.35	6.13	--NA--	"FUNCTION:N-acetyl-D-glucosamine-specific lectin. Specifically agglutinates rabbit erythrocytes.BIOPHYSICOCHEMICAL PROPERTIES:pH dependence: Optimum pH is 6.0-8.0. No activity below pH 3.0 or above pH 11.0; Temperature dependence: Thermostable. Activity unaffected after incubation for 30 minutes at 30-70 degrees Celsius. Retains 50% of its maximal activity after incubation at 80 degrees Celsius for 30 minutes;SUBUNIT:Monomer.MISCELLANEOUS:Divalent cations are required for ligand binding.Calcium is the most effective, but manganese or zinc can also be used to a lesser extent."