Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_4021 |
| Peptide Name | PSBU_KARBR |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Karenia brevis |
| Plant Source (Common Name) | Dinoflagellate |
| Plant Family | Kareniaceae |
| Peptide Family | --NA-- |
| Peptide Function | Signaling-peptide |
| Peptide Function Description | Chloroplast; Electron transport; Membrane; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transit peptide; Transport | Photosystem II 12 kDa extrinsic protein, chloroplast precursor (PS II,complex 12 kDa extrinsic protein) (PSII-U).Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Lumenal si |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | AAGKLCTNGPYVDLKDMYAKAKLSKEEEAIVKEFDKDFLFLKPQIEYVVDMQKMAMLMACLACMGLAAAFSPATLGVNKPSHRQQAPVMSQVARRELLSKNLNNGLYRRVLGAAALLGAASADAKVNYDAVAYLGGAQQIDVNNANIRVYQKLPGMYPS |
| Sequence Length | 159 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 17277.16 |
| Monoisotopic Molecular Weight (Da) | 17265.87 |
| Isoelectric Point (pI) | 9.1 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q00GL7 |
| NCBI | --NA-- |
| EMBL | DQ531591 |
| Link to Source Databases | SPdb202187 |
|---|
| Addtional Information | FUNCTION:Stabilizes the structure of photosystem II oxygen- evolving complex (OEC), the ion environment of oxygen evolution and protects the OEC against heat-induced inactivation (By similarity).SUBUNIT:Part of the oxygen-evolving complex of photosystem II (By similarity).PTM:Might be translocated into the thylakoid lumen by the Tat system. The position of the signal and transit peptide cleavages have not been experimentally proven.SIMILARITY:Belongs to the psbU family. |
