PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4021	PSBU_KARBR	--NA--	"Karenia brevis"	Kareniaceae	--NA--	Signaling-peptide	"Chloroplast; Electron transport; Membrane; Photosynthesis; Photosystem II; Plastid; Signal; Thylakoid; Transit peptide; Transport | Photosystem II 12 kDa extrinsic protein, chloroplast precursor (PS II,complex 12 kDa extrinsic protein) (PSII-U).Plastid, chloroplast thylakoid membrane; Peripheral membrane protein; Lumenal si"	--NA--	AAGKLCTNGPYVDLKDMYAKAKLSKEEEAIVKEFDKDFLFLKPQIEYVVDMQKMAMLMACLACMGLAAAFSPATLGVNKPSHRQQAPVMSQVARRELLSKNLNNGLYRRVLGAAALLGAASADAKVNYDAVAYLGGAQQIDVNNANIRVYQKLPGMYPS	159	"Experimental evidence at transcript level"	17277.16	17265.87	9.1	--NA--	"FUNCTION:Stabilizes the structure of photosystem II oxygen- evolving complex (OEC), the ion environment of oxygen evolution and protects the OEC against heat-induced inactivation (By similarity).SUBUNIT:Part of the oxygen-evolving complex of photosystem II (By similarity).PTM:Might be translocated into the thylakoid lumen by the Tat system. The position of the signal and transit peptide cleavages have not been experimentally proven.SIMILARITY:Belongs to the psbU family."