Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_3969
Peptide Name	Antimicrobial peptide Ac-AMP2
PMID(s)	1567877, 12387889, 8089137
Plant Source (Scientific Name)	Amaranthus caudatus, Amaranthus hypochondriacus
Plant Source (Common Name)	amaranth inca-Wheat, prince-of-Wales feather
Plant Family	Amaranthaceae
Peptide Family	Hevein
Peptide Function	Antibacterial, Antifungal, Alpha-amylase-inhibitor
Peptide Function Description	is active against numerous chitin-containing fungal pathogenes and Gram-positive bacteria, It strongly inhibits the alpha-amylase activity of insect larvae and does not inhibit proteases and mammalian alpha-amylases
Activity Against	Fungi: Alternaria brassicola (IC50 = 7 µg/mL), Ascochyta pisi (IC50 = 8 µg/mL), Botrytis cinera (IC50 = 10 µg/mL), Colletotrichum lindemuthianum (IC50 = 8 µg/mL), Fusarium culmorum (IC50 = 2 µg/mL), Trichoderma hamatum (IC50 = 7 µg/mL), Verticillium dahliae (IC50 = 6 µg/mL). Gram-positive bacteria: Bacillus megaterium (IC50 = 40 µg/mL), Sarcina lutea (IC50 = 250 µg/mL).
IC50 value	7 µg/mL | 8 µg/mL | 10 µg/mL | 8 µg/mL | 2 µg/mL | 7 µg/mL | 6 µg/mL 40 µg/mL | 250 µg/mL
Sequence	VGECVRGRCPSGMCCSQFGYCGKGPKYCGR
Sequence Length	30
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	3189.74
Monoisotopic Molecular Weight (Da)	3187.35
Isoelectric Point (pI)	8.92
Method / Extraction	NMR

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_3969

External links (Uniprot, PDB and Source Information Database)
Uniprot	Q9S8Z7, P27275, A0SZY3, A0SZY6, Q71U16, A0SZY5, A0SZY4, A0SZY2, A0SZY1, A0SZY0, A0SZX9
NCBI	1703289
EMBL	--NA--
Link to Source Databases	PhytAMP_PHYT00223, DBAASP_1135, EROP-Moscow_03985, CAMPSQ189, APD_00194
Addtional Information	Synthesis Type : Ribosomal; Compared to Ac-AMP1, Ac-AMP2 contains one additional residue (Arg) at the C-terminus. Three disulfide bridges: 4,15; 9,21;14,28. NMR studies were performed by Matins JC et al. 1996 J Mol Biol 258: 322. You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014.