PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3969	"Antimicrobial peptide Ac-AMP2"	"1567877, 12387889, 8089137"	"Amaranthus caudatus, Amaranthus hypochondriacus"	Amaranthaceae	Hevein	"Antibacterial, Antifungal, Alpha-amylase-inhibitor"	"is active against numerous chitin-containing fungal pathogenes and Gram-positive bacteria, It strongly inhibits the alpha-amylase activity of insect larvae and does not inhibit proteases and mammalian alpha-amylases"	"Fungi: Alternaria brassicola (IC50 = 7 µg/mL), Ascochyta pisi (IC50 = 8 µg/mL), Botrytis cinera (IC50 = 10 µg/mL), Colletotrichum lindemuthianum (IC50 = 8 µg/mL), Fusarium culmorum (IC50 = 2 µg/mL), Trichoderma hamatum (IC50 = 7 µg/mL), Verticillium dahliae (IC50 = 6 µg/mL). Gram-positive bacteria: Bacillus megaterium (IC50 = 40 µg/mL), Sarcina lutea (IC50 = 250 µg/mL)."	VGECVRGRCPSGMCCSQFGYCGKGPKYCGR	30	"Experimental evidence at protein level"	3189.74	3187.35	8.92	NMR	"Synthesis Type : Ribosomal; Compared to Ac-AMP1, Ac-AMP2 contains one additional residue (Arg) at the C-terminus. Three disulfide bridges: 4,15; 9,21;14,28. NMR studies were performed by Matins JC et al. 1996 J Mol Biol 258: 322. You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014."