Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3967 |
| Peptide Name | Ar-AMP |
| PMID(s) | 16126239 |
| Plant Source (Scientific Name) | Amaranthus retroflexus |
| Plant Source (Common Name) | Redroot amaranth |
| Plant Family | Amaranthaceae |
| Peptide Family | Hevein |
| Peptide Function | Antimicrobial, Antibacterial, Antifungal |
| Peptide Function Description | inhibits the growth of the fungal patogens; possesses antibacterial activity against Gram-positive bacteria Bacillus subtilis, Target site: lipid bilayer; Chitin-binding peptide |
| Activity Against | Fungi: B.cinerea, F.culmorum, H.sativum and A.consortiale, but not that of R.solani. NOTE! Induces morphological changes in F.culmorum, H.sativum and R.solani, but not in A.consortiale. |
| IC50 value | --NA-- |
| Sequence | AGECVQGRCPSGMCCSQFGYCGRGPKYCGR |
| Sequence Length | 30 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3161.65 |
| Monoisotopic Molecular Weight (Da) | 3159.28 |
| Isoelectric Point (pI) | 8.68 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q5I2B2 |
| NCBI | 75284710 |
| EMBL | --NA-- |
| Link to Source Databases | PhytAMP_PHYT00224, DBAASP_3163, EROP-Moscow_06103, CAMPSQ743, APD_00912 |
|---|
| Addtional Information | Synthesis Type : Ribosomal; It potentially contains three pairs of disulfide bonds.It effectively inhibited the growth of different fungi tested: Fusarium culmorium (Smith) Sacc., Helminthosporium sativum Pammel., King et Bakke, Alternaria consortiale Fr., and Botrytis cinerea Pers., caused morphological changes in Rhizoctonia solani at micromolar concentrations and protected barley seedlings from H. sativum infection. |
