PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3967	Ar-AMP	16126239	"Amaranthus retroflexus"	Amaranthaceae	Hevein	"Antimicrobial, Antibacterial, Antifungal"	"inhibits the growth of the fungal patogens; possesses antibacterial activity against Gram-positive bacteria Bacillus subtilis, Target site: lipid bilayer; Chitin-binding peptide"	"Fungi: B.cinerea, F.culmorum, H.sativum and A.consortiale, but not that of R.solani. NOTE! Induces morphological changes in F.culmorum, H.sativum and R.solani, but not in A.consortiale."	AGECVQGRCPSGMCCSQFGYCGRGPKYCGR	30	"Experimental evidence at protein level"	3161.65	3159.28	8.68	--NA--	"Synthesis Type : Ribosomal; It potentially contains three pairs of disulfide bonds.It effectively inhibited the growth of different fungi tested: Fusarium culmorium (Smith) Sacc., Helminthosporium sativum Pammel., King et Bakke, Alternaria consortiale Fr., and Botrytis cinerea Pers., caused morphological changes in Rhizoctonia solani at micromolar concentrations and protected barley seedlings from H. sativum infection. "