Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3966 |
| Peptide Name | Leaf cyclotide 1 (Vhl-1) |
| PMID(s) | 15824119, 20564013, 18618891 |
| Plant Source (Scientific Name) | Viola hederacea |
| Plant Source (Common Name) | Native Violet |
| Plant Family | Violaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Antiviral, Antifungal, Nematocide, Anti-HIV |
| Peptide Function Description | Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 55.2 ±1.5 µM |
| Activity Against | Virus: HIV (EC50= 0.87 µM). NOTE! vhl-1 was not active against Escherichia coli, Staphylococcus aureus, and Candida albicans. |
| IC50 value | --NA-- |
| Sequence | SISCGESCAMISFCFTEVIGCSCKNKVCYLN |
| Sequence Length | 31 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3340.94 |
| Monoisotopic Molecular Weight (Da) | 3338.43 |
| Isoelectric Point (pI) | 5.85 |
| Method / Extraction | MS, Amino acid analysis |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P84522 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | PhytAMP_PHYT00206, DBAASP_2537, Cybase_86, CAMPSQ3000, APD_01058 |
|---|
| Addtional Information | Synthesis Type : Ribosomal|Inhibition of the cytopathic effects of HIV infection; N-SFTI-1-C with Lys5 substituted with N-(4-aminobutyl)-glycine residue; You can rotate, zoom, and view the 3D structure here in the PDB . Met7 was found to be oxidized to Met sulfoxide by methionine sulfoxide reductase (MsrA; EC 1.8.4.6). Will this oxidation play a role in repair oxidative damage? This peptide showed an effect on viruses such as HIV. Updated 2/2014. |
