PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3966	"Leaf cyclotide 1 (Vhl-1)"	"15824119, 20564013, 18618891"	"Viola hederacea"	Violaceae	Cyclotide	"Antibacterial, Antiviral, Antifungal, Nematocide, Anti-HIV"	"Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 55.2 ±1.5 µM"	"Virus: HIV (EC50= 0.87 µM). NOTE! vhl-1 was not active against Escherichia coli, Staphylococcus aureus, and Candida albicans."	SISCGESCAMISFCFTEVIGCSCKNKVCYLN	31	"Experimental evidence at protein level"	3340.94	3338.43	5.85	"MS, Amino acid analysis"	"Synthesis Type : Ribosomal|Inhibition of the cytopathic effects of HIV infection; N-SFTI-1-C with Lys5 substituted with N-(4-aminobutyl)-glycine residue; You can rotate, zoom, and view the 3D structure here in the PDB . Met7 was found to be oxidized to Met sulfoxide by methionine sulfoxide reductase (MsrA; EC 1.8.4.6). Will this oxidation play a role in repair oxidative damage? This peptide showed an effect on viruses such as HIV. Updated 2/2014."