Detailed Peptide Information

This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking

Primary Information
PPepDB ID	PPepDB_3958
Peptide Name	MJ-AMP1
PMID(s)	1733929, 7647302
Plant Source (Scientific Name)	Mirabilis jalapa
Plant Source (Common Name)	Garden four-o'clock
Plant Family	Nyctaginaceae
Peptide Family	Knottin
Peptide Function	Antibacterial, Antifungal
Peptide Function Description	Shown to possess strong antifungal activity
Activity Against	Gram-positive bacteria: Bacillus megaterium (IC50= 6 µg/mL), Sarcina lutea (IC50= 100 µg/mL). NOTE! not active against Erwinia carotovora, Escherichia coli. Fungi: Alternaria brassicola (IC50= 20 µg/mL), Ascochyta pisi (IC50= 200 µg/mL), Botrytis cinerea (IC50= 50 µg/mL), Cercospora beticola (IC50= 10 µg/mL), Colletotrichum lindemuthianum (IC50= 5 µg/mL), Fusarium culmorum (IC50= 30 µg/mL), Fusarium oxysporum f. sp. Pisi (IC50= 15 µg/mL), Fusarium oxysporum f. sp. Lycopersici (IC50= 200 µg/mL), Nectria haematococca (IC50= 15 µg/mL), Phoma betae (IC50= 25 µg/mL), Pyrenophora tritici-repentis (IC50= 300 µg/mL), Pyricularia oryzae (IC50= 6 µg/mL), Rhizoctonia solani (IC50= 60 µg/mL), Verticiliium dahliae (IC50= 12 µg/mL), Venturia inaequalis (IC50= 12 µg/mL).
IC50 value	6 µg/mL | 100 µg/mL | 20 µg/mL | 200 µg/mL | 50 µg/mL | 10 µg/mL | 5 µg/mL | 30 µg/mL | 15 µg/mL | 200 µg/mL | 15 µg/mL | 25 µg/mL | 300 µg/mL | 6 µg/mL | 60 µg/mL | 12 µg/mL | 12 µg/mL
Sequence	QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR
Sequence Length	37
Validation	Experimental evidence at protein level
Average Molecular Weight (Da)	4000.51
Monoisotopic Molecular Weight (Da)	3997.71
Isoelectric Point (pI)	8.66
Method / Extraction	--NA--

Secondary Information
Tertiary Structure and DSSP Report	Click to View Structure
Physico-Chemical Properties of peptides	Click to View Physico-Chemical Details of PPepDB_3958

External links (Uniprot, PDB and Source Information Database)
Uniprot	P25403
NCBI	1703271
EMBL	--NA--
Link to Source Databases	PhytAMP_PHYT00270, CAMPSQ187, APD_00203
Addtional Information	Three disulfide bonds.Transgenic plants: expression of this peptide in tomato enhances resistance to early blight disease (Planta. 2005 Nov;222(5):858-66).