PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3958	MJ-AMP1	"1733929, 7647302"	"Mirabilis jalapa"	Nyctaginaceae	Knottin	"Antibacterial, Antifungal"	"Shown to possess strong antifungal activity"	"Gram-positive bacteria: Bacillus megaterium (IC50= 6 µg/mL), Sarcina lutea (IC50= 100 µg/mL). NOTE! not active against Erwinia carotovora, Escherichia coli. Fungi: Alternaria brassicola (IC50= 20 µg/mL), Ascochyta pisi (IC50= 200 µg/mL), Botrytis cinerea (IC50= 50 µg/mL), Cercospora beticola (IC50= 10 µg/mL), Colletotrichum lindemuthianum (IC50= 5 µg/mL), Fusarium culmorum (IC50= 30 µg/mL), Fusarium oxysporum f. sp. Pisi (IC50= 15 µg/mL), Fusarium oxysporum f. sp. Lycopersici (IC50= 200 µg/mL), Nectria haematococca (IC50= 15 µg/mL), Phoma betae (IC50= 25 µg/mL), Pyrenophora tritici-repentis (IC50= 300 µg/mL), Pyricularia oryzae (IC50= 6 µg/mL), Rhizoctonia solani (IC50= 60 µg/mL), Verticiliium dahliae (IC50= 12 µg/mL), Venturia inaequalis (IC50= 12 µg/mL)."	QCIGNGGRCNENVGPPYCCSGFCLRQPGQGYGYCKNR	37	"Experimental evidence at protein level"	4000.51	3997.71	8.66	--NA--	"Three disulfide bonds.Transgenic plants: expression of this peptide in tomato enhances resistance to early blight disease (Planta. 2005 Nov;222(5):858-66). "