Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_3857 |
| Peptide Name | Rs-AFP2 |
| PMID(s) | 7780308, 26592804, 14604982, 1639777, 9636715 |
| Plant Source (Scientific Name) | Raphanus sativus |
| Plant Source (Common Name) | Radish |
| Plant Family | Brassicaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal |
| Peptide Function Description | Exhibit potent antifungal activity in vitro. |
| Activity Against | Fungi: Alternaria brassicola (IC50= 2 µg/mL), Botrytis cinerea (IC50= 2 µg/mL), Fusarium culmorum (IC50= 2 µg/mL), Fusarium oxysporum (IC50= 2 µg/mL), Pyricularia oryzae (IC50= 0.4 µg/mL), Verticiliium dahliae (IC50= 1.5 µg/mL). NOTE! Not tested against bacteria. |
| IC50 value | 2 µg/mL | 2 µg/mL | 2 µg/mL | 2 µg/mL | 0.4 µg/mL | 1.5 µg/mL |
| Sequence | QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Sequence Length | 51 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5735.65 |
| Monoisotopic Molecular Weight (Da) | 5731.63 |
| Isoelectric Point (pI) | 9.08 |
| Method / Extraction | SDS-PAGE, Immunoblotting, Cation exchange chromatography and Reversed-phase chromatography |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P30230 |
| NCBI | 1703206 |
| EMBL | --NA-- |
| Link to Source Databases | PhytAMP_PHYT00053, DEFENSINS-Knowledgebase_290, CAMPSQ922, APD_00287 |
| Addtional Information | It induces apoptosis and impairs the yeast-to-hypha transition in C. albicans. Adapts typical cysteine-stabilized AsgAt-motif of plant defensins, Shows differential antifungal/antibiofilm potency, Signal peptide: 1-29; Mature peptide: 30-80; This structure comprises a triple-stranded beta-sheet with an alpha-helix in parallel.; Both alpha-helix and beta-structure |