PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3857	Rs-AFP2	"7780308, 26592804, 14604982, 1639777, 9636715"	"Raphanus sativus"	Brassicaceae	Defensin	Antifungal	"Exhibit potent antifungal activity in vitro."	"Fungi: Alternaria brassicola (IC50= 2 µg/mL), Botrytis cinerea (IC50= 2 µg/mL), Fusarium culmorum (IC50= 2 µg/mL), Fusarium oxysporum (IC50= 2 µg/mL), Pyricularia oryzae (IC50= 0.4 µg/mL), Verticiliium dahliae (IC50= 1.5 µg/mL). NOTE! Not tested against bacteria."	QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC	51	"Experimental evidence at protein level"	5735.65	5731.63	9.08	"SDS-PAGE, Immunoblotting, Cation exchange chromatography and Reversed-phase chromatography"	"It induces apoptosis and impairs the yeast-to-hypha transition in C. albicans. Adapts typical cysteine-stabilized AsgAt-motif of plant defensins, Shows differential antifungal/antibiofilm potency, Signal peptide: 1-29; Mature peptide: 30-80; This structure comprises a triple-stranded beta-sheet with an alpha-helix in parallel.; Both alpha-helix and beta-structure"