Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_3851 |
| Peptide Name | Fa-AMP2 |
| PMID(s) | 12951494 |
| Plant Source (Scientific Name) | Fagopyrum esculentum |
| Plant Source (Common Name) | BuckWheat |
| Plant Family | Polygonaceae |
| Peptide Family | Defensin, Hevein |
| Peptide Function | Antibacterial, Antifungal |
| Peptide Function Description | Shows antibacterial and antifungal activity in different species, inhibits growth of plant patogenic fungi (IC50=25-29 µg/ml), Gram-positive (IC50=13-14 µg/ml) and Gram-negative (IC50=11-24 µg/ml) bacteria. |
| Activity Against | Erwinia carotovora (IC50=15g/mL), Agrobacterium radiobacter (IC50=17g/mL), Agrobacterium rhizogenes (IC50=24g/mL), Clavibacter michiganensis (IC50=17g/mL), Curtobacterium flaccumfaciens (IC50=15g/mL), Fusarium oxysporum (IC50=29g/mL), Geotrichum candidum (IC50=25g/mL) |
| IC50 value | 15 µg/mL | 17 µg/mL | 24 µg/mL | 17 µg/mL | 15 µg/mL | 29 µg/mL | 25 µg/mL |
| Sequence | AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR |
| Sequence Length | 40 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3915.39 |
| Monoisotopic Molecular Weight (Da) | 3912.52 |
| Isoelectric Point (pI) | 8.23 |
| Method / Extraction | MALDI-TOF MS a-lysis |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | P0DKH8 |
| NCBI | 745997997 |
| EMBL | --NA-- |
| Link to Source Databases | EROP-Moscow_05771, CAMPSQ8181, APD_01588 |
| Addtional Information | Rich in Cys and Gly residues. It differs from Fa-AMP1 only in the last residue: Lys in Fa-AMP1 abd Arg in Fa-AMP2. For plant pathogenic bacterial and fungal strains, see APD entries 1585. |