PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3851	Fa-AMP2	12951494	"Fagopyrum esculentum"	Polygonaceae	"Defensin, Hevein"	"Antibacterial, Antifungal"	"Shows antibacterial and antifungal activity in different species, inhibits growth of plant patogenic fungi (IC50=25-29 µg/ml), Gram-positive (IC50=13-14 µg/ml) and Gram-negative (IC50=11-24 µg/ml) bacteria."	"Erwinia carotovora (IC50=15g/mL), Agrobacterium radiobacter (IC50=17g/mL), Agrobacterium rhizogenes (IC50=24g/mL), Clavibacter michiganensis (IC50=17g/mL), Curtobacterium flaccumfaciens (IC50=15g/mL), Fusarium oxysporum (IC50=29g/mL), Geotrichum candidum (IC50=25g/mL)"	AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR	40	"Experimental evidence at protein level"	3915.39	3912.52	8.23	"MALDI-TOF MS a-lysis"	"Rich in Cys and Gly residues. It differs from Fa-AMP1 only in the last residue: Lys in Fa-AMP1 abd Arg in Fa-AMP2. For plant pathogenic bacterial and fungal strains, see APD entries 1585."