Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3842 |
| Peptide Name | Aspartic acid-reach plypeptide Lunasin |
| PMID(s) | PPepDB_3842_ref1, 3611081 |
| Plant Source (Scientific Name) | Glycine max |
| Plant Source (Common Name) | Soybean |
| Plant Family | Fabaceae |
| Peptide Family | --NA-- |
| Peptide Function | Immunomodulatory, Anti-inflammatory, Antimicrobial, Anticancer |
| Peptide Function Description | Shows in vitro anti-inflammatory activity by inhibiting COX-2/PGE2 and iNOS/NO pathways. |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Sequence Length | 43 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5028.36 |
| Monoisotopic Molecular Weight (Da) | 5025.23 |
| Isoelectric Point (pI) | 4.43 |
| Method / Extraction | Ion-exchange chromatography, ultrafiltration and size exclusion chromatography, Western blot, HPLC, MALDI-TOF and LC/MS-MS. |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P19594 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | EROP-Moscow_01558, APD_02329 |
|---|
| Addtional Information | The peptide was isolated from soybeans in 2003 (PubMed). Showed 30% similarity to EcAMP2 (AP2042). This peptide contains 8 Asp (D) residues in its carboxyl end preceded by a cell adhesion motif RGD. Found also in barley and wheat. Found in multiple species. |
