PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3842	"Aspartic acid-reach plypeptide Lunasin"	"doi.org/10.1016/j.foodchem.2008.09.023, 3611081"	"Glycine max"	Fabaceae	--NA--	"Immunomodulatory, Anti-inflammatory, Antimicrobial, Anticancer"	"Shows in vitro anti-inflammatory activity by inhibiting COX-2/PGE2 and iNOS/NO pathways."	--NA--	SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD	43	"Experimental evidence at protein level"	5028.36	5025.23	4.43	"Ion-exchange chromatography, ultrafiltration and size exclusion chromatography, Western blot, HPLC, MALDI-TOF and LC/MS-MS."	"The peptide was isolated from soybeans in 2003 (PubMed). Showed 30% similarity to EcAMP2 (AP2042). This peptide contains 8 Asp (D) residues in its carboxyl end preceded by a cell adhesion motif RGD. Found also in barley and wheat. Found in multiple species. "