Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_3809 |
| Peptide Name | gamma2-purothionins |
| PMID(s) | 2226781, 27208129 |
| Plant Source (Scientific Name) | Triticum aestivum |
| Plant Source (Common Name) | Wheat |
| Plant Family | Poaceae |
| Peptide Family | Thionin |
| Peptide Function | Cytotoxic, Antibacterial, Protein-synthesis-inhibitor |
| Peptide Function Description | Target site- Lipid Bilayer; inhibits protein synthesis in eukaryotic cell-free system; Shows cytotoxic activity. The toxic effect of thionins to certain strains of yeasts, high organisms and cultured cells, as well as the possibility to form immunotoxins specifically toxic to target cells of the conjugated antibody. |
| Activity Against | Lactobacillus brevis ,Pediococcus dextrinicus ,Staphylococcus aureus Newman,Salmonella typhimurium SL1344 |
| IC50 value | --NA-- |
| Sequence | KVCRQRSAGFKGPCVSDKNCAQVCLQEGWGGGNCDGPFRRCKCIRQC |
| Sequence Length | 47 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5150.98 |
| Monoisotopic Molecular Weight (Da) | 5147.37 |
| Isoelectric Point (pI) | 9.12 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | P20159, A0A060AJU4 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_9726, PhytAMP_PHYT00029, EROP-Moscow_03017 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; 95% Inhibition against Lactobacillus brevis at >50 ¼g/ml; 95% Inhibition against Pediococcus dextrinicus at >50 ¼g/ml; 95% Inhibition against Staphylococcus aureus Newman at >50 ¼g/ml; 95% inhibition against Salmonella typhimurium at >50 ¼g/ml |
