PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3809	gamma2-purothionins	"2226781, 27208129"	"Triticum aestivum"	Poaceae	Thionin	"Cytotoxic, Antibacterial, Protein-synthesis-inhibitor"	"Target site- Lipid Bilayer; inhibits protein synthesis in eukaryotic cell-free system; Shows cytotoxic activity. The toxic effect of thionins to certain strains of yeasts, high organisms and cultured cells, as well as the possibility to form immunotoxins specifically toxic to target cells of the conjugated antibody."	"Lactobacillus brevis ,Pediococcus dextrinicus ,Staphylococcus aureus Newman,Salmonella typhimurium SL1344"	KVCRQRSAGFKGPCVSDKNCAQVCLQEGWGGGNCDGPFRRCKCIRQC	47	"Experimental evidence at protein level"	5150.98	5147.37	9.12	--NA--	"Synthesis Type: Ribosomal; 95% Inhibition against Lactobacillus brevis at >50 ¼g/ml; 95% Inhibition against Pediococcus dextrinicus at >50 ¼g/ml; 95% Inhibition against Staphylococcus aureus Newman at >50 ¼g/ml; 95% inhibition against Salmonella typhimurium at >50 ¼g/ml"