Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_3805 |
| Peptide Name | Cycloviolacin Y5 |
| PMID(s) | PPepDB_3805_ref1, 18618891, 18081259 |
| Plant Source (Scientific Name) | Viola odorata |
| Plant Source (Common Name) | Sweet violet |
| Plant Family | Violaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antimicrobial, Nematocide, Hemolytic, Anti-HIV, Antiviral |
| Peptide Function Description | Participate in the innate immune response of plants, therapeutically useful as anticancer agents and novel antimicrobial compounds in the protection of crops to the disinfection of hospital environments; Shown to possess nematocidal, hemolytic and anti-HIV activity. |
| Activity Against | Haemonchus contortus and Trichostrongylus colubriformis, HIV |
| IC50 value | --NA-- |
| Sequence | GIPCAESCVWIPCTVTALVGCSCSDKVCYN |
| Sequence Length | 30 |
| Validation | Experimental evidence at transcript level |
| Average Molecular Weight (Da) | 3122.67 |
| Monoisotopic Molecular Weight (Da) | 3120.36 |
| Isoelectric Point (pI) | 4.37 |
| Method / Extraction | MS |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | B5B3Z0 |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | CAMPSQ770, APD_01081, Cybase_351 |
| Addtional Information | Cycloviolacins Y4 and Y5 are more hydrophobic (>50%) than cycloviolacin Y1 (33%, entry 1077), thereby more hemolytic. |