PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3805	"Cycloviolacin Y5"	"doi.org/10.1080/07352689.2013.773238, 18081259"	"Viola odorata"	Violaceae	Cyclotide	"Antimicrobial, Nematocide, Hemolytic, Anti-HIV, Antiviral"	"Participate in the innate immune response of plants, therapeutically useful as anticancer agents and novel antimicrobial compounds in the protection of crops to the disinfection of hospital environments; Shown to possess nematocidal, hemolytic and anti-HIV activity."	"Haemonchus contortus and Trichostrongylus colubriformis, HIV"	GIPCAESCVWIPCTVTALVGCSCSDKVCYN	30	"Experimental evidence at transcript level"	3122.67	3120.36	4.37	MS	"Cycloviolacins Y4 and Y5 are more hydrophobic (>50%) than cycloviolacin Y1 (33%, entry 1077), thereby more hemolytic."