Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
| PPepDB ID | PPepDB_2995 |
| Peptide Name | Antimicrobial peptide OsDEF7 |
| PMID(s) | 27527801 |
| Plant Source (Scientific Name) | Oryza sativa |
| Plant Source (Common Name) | Rice |
| Plant Family | Poaceae |
| Peptide Family | --NA-- |
| Peptide Function | Antimicrobial, Antibacterial, Antifungal |
| Peptide Function Description | active against Gram-negative bacteria (Xanthomonas oryzae, MIC=3.9 µg/mL and Erwinia carotovora, MIC=63 µg/mL); fungus (Harpophora oryzae, MIC=15 µg/mL). |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | RHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC |
| Sequence Length | 49 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5552.41 |
| Monoisotopic Molecular Weight (Da) | 5548.5 |
| Isoelectric Point (pI) | 8.92 |
| Method / Extraction | --NA-- |
| External links (Uniprot, PDB and Source Information Database) |
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | EROP-Moscow_15349, APD_02852 |
| Addtional Information | APD analysis reveals that the sequence of this peptide shows 75.5% similarity to sugarcane defensin 1. Molecular formula: C227H369N73O69S9; Mol Wt 5552.454; GRAVY= -0.63; Wimley-White whole-residue hydrophobicity of the peptide: 12.95 kcal/mol. Active against X. oryzae pv. oryzae, X. oryzae pv. oryzicola (causing a serious blight of rice) (MIC 3.9 ug/mL), E. carotovora (MIC 63 ug/mL), fungi H. oryzae (MIC 15 ug/mL). Upon Xanthomonas oryzae pv. oryzae infection in the leaves, both OsDEFs are highly upregulated at 8 days post-infection and located in the extracellular compartment, suggesting a role in host defense (Weerawanich et al., 2018). Updated 2/2018. |