PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2995	"Antimicrobial peptide OsDEF7"	27527801	"Oryza sativa"	Poaceae	--NA--	"Antimicrobial, Antibacterial, Antifungal"	"active against Gram-negative bacteria (Xanthomonas oryzae, MIC=3.9 µg/mL and Erwinia carotovora, MIC=63 µg/mL); fungus (Harpophora oryzae, MIC=15 µg/mL)."	--NA--	RHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC	49	"Experimental evidence at protein level"	5552.41	5548.5	8.92	--NA--	"APD analysis reveals that the sequence of this peptide shows 75.5% similarity to sugarcane defensin 1. Molecular formula: C227H369N73O69S9; Mol Wt 5552.454; GRAVY= -0.63; Wimley-White whole-residue hydrophobicity of the peptide: 12.95 kcal/mol. Active against X. oryzae pv. oryzae, X. oryzae pv. oryzicola (causing a serious blight of rice) (MIC 3.9 ug/mL), E. carotovora (MIC 63 ug/mL), fungi H. oryzae (MIC 15 ug/mL). Upon Xanthomonas oryzae pv. oryzae infection in the leaves, both OsDEFs are highly upregulated at 8 days post-infection and located in the extracellular compartment, suggesting a role in host defense (Weerawanich et al., 2018). Updated 2/2018."