Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_266 |
| Peptide Name | AhPDF1.1 |
| PMID(s) | --NA-- |
| Plant Source (Scientific Name) | Arabidopsis halleri |
| Plant Source (Common Name) | --NA-- |
| Plant Family | Brassicaceae |
| Peptide Family | Defensin |
| Peptide Function | Antifungal |
| Peptide Function Description | --NA-- |
| Activity Against | --NA-- |
| IC50 value | --NA-- |
| Sequence | QRLCEKPSGTWSGVCGNNGACRNQCIRLEKARHGSCNYVFPAHKCICYFPC |
| Sequence Length | 51 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5707.59 |
| Monoisotopic Molecular Weight (Da) | 5703.6 |
| Isoelectric Point (pI) | 8.92 |
| Method / Extraction | NMR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | --NA-- |
| NCBI | --NA-- |
| EMBL | --NA-- |
| Link to Source Databases | APD_02522 |
|---|
| Addtional Information | N-terminus is a pyroglutamate. The sequence of this entry is 94.1% SIMILAR TO plant Ac-AFP4 . Active against the filamentous fungus F. oxysporum (MIC 0.6 uM). The 3D structure of this peptide obtained by chemical synthesis has been determined (Meindre F et al., 2014). You can rotate, zoom, and view the 3D structure here in the PDB. This defensin was initialy reported to confer zinc tolerance (Mirouze M et al., 2006). The four consecutive residues (Val39-Phe40-Pro41-Ala42) are strictly conserved for plant defensins able to tolerate zinc. |
