PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_266	AhPDF1.1	--NA--	"Arabidopsis halleri"	Brassicaceae	Defensin	Antifungal	--NA--	--NA--	QRLCEKPSGTWSGVCGNNGACRNQCIRLEKARHGSCNYVFPAHKCICYFPC	51	"Experimental evidence at protein level"	5707.59	5703.6	8.92	NMR	"N-terminus is a pyroglutamate. The sequence of this entry is 94.1% SIMILAR TO plant Ac-AFP4 . Active against the filamentous fungus F. oxysporum (MIC 0.6 uM). The 3D structure of this peptide obtained by chemical synthesis has been determined (Meindre F et al., 2014). You can rotate, zoom, and view the 3D structure here in the PDB. This defensin was initialy reported to confer zinc tolerance (Mirouze M et al., 2006). The four consecutive residues (Val39-Phe40-Pro41-Ala42) are strictly conserved for plant defensins able to tolerate zinc. "