This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2226 |
| Peptide Name | Cycloviolacin-O2 |
| PMID(s) | 12477048, 6872274, 20580652, 21723349, 28669767 |
| Plant Source (Scientific Name) | Viola odorata, Viola biflora |
| Plant Source (Common Name) | native Australian violet, Sweet violet, alpine yellow-violet |
| Plant Family | Violaceae |
| Peptide Family | Cyclotide |
| Peptide Function | Antibacterial, Anticancer, Antifungal, Cytotoxic, Nematocide, Membrane-Binding, Hemolytic, Anti-barnacle, Antiparasitic, Antimicrobial |
| Peptide Function Description | Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization ; Cycloviolacin O2 shown to possess cytotoxic activity in cancer cells and have specific membrane-disrupting activity; Cycloviolacin O2 exhibited strong cytotoxic activities; Cycloviolacin O2 affect the motility; Disruption of cell membranes plays a crucial role in the cytotoxic effect of the cyclotide cycloviolacin O2; Shown to possess hemolytic activity; Shown to possess anti-barnacle activity; Target site: lipid bilayer; Human lymphocytes(IC50: 0.87 µM); 50% Hemolysis against Human erythrocytes at 36 µM; Human foreskin fibroblasts HFF-1(IC50: 1.29 ±0.07 µM) |
| Activity Against | Human Myeloma cells RPMI-8226/s (IC50: 0.12 µM), Human Myeloma cells RPMI-8226/Dox40 (IC50: 0.12 µM), Human Myeloma cells RPMI-8226/LR-5 (IC50: 0.12 µM), Human histiocytic lymphoma U-937/GTB (IC50: 0.26 µM), Human histiocytic lymphoma U-937-Vcr (IC50: 0.20 µM), Human renal adenocarcinoma ACHN (IC50: 0.22 µM), Human lymphoblastic leukemia CCRF-CEM (IC50: 0.11 µM), Human lymphoblastic leukemia CCRF-CEM/VM-1 (IC50: 0.14 µM), Human lung carcinoma NCI-H69 (IC50: 0.12 µM), Human lung carcinoma NCI-H69AR (IC50: 0.26 µM), Chronic lymphocytic leukemia (IC50: 0.10 µM), Ovarian carcinoma (IC50: 1.32 µM), Human glioblastoma U251-MG (IC50: 17.05 µg/ml), Human breast adenocarcinoma MDA-MB-231 (IC50: 4.81 µg/ml), Human lung carcinoma A549 (IC50: 5.99 µg/ml), Human prostate cancer DU145 (IC50: 5.08 µg/ml), Human hepatocarcinoma BEL-7402 (IC50: 6.07 µg/ml), Human skin melanoma MM96L (IC50: 0.65 ±0.06 µM), Human cervical carcinoma HeLa (IC50: 3.43 ±0.15 µM), Human gastric cancer BGC-823 (IC50: 4.81 ±0.48 µM), Escherichia coli (MBC50: 5 µM), Escherichia coli (MBC99: 10 µM), Escherichia coli (MIC: 20 µM), Escherichia coli (MIC: 160 µM), Escherichia coli (MIC: 160 µM), Escherichia coli (MIC: 80 µM), Pseudomonas aeruginosa (MBC50: 5 µM), Pseudomonas aeruginosa (MBC99: 5 µM), Pseudomonas aeruginosa (MIC: 10 µM), Pseudomonas aeruginosa (MIC: 80 µM), Pseudomonas aeruginosa (MIC: 160 µM), Staphylococcus aureus (MBC50: 10 µM), Staphylococcus aureus (MBC99: 20 µM), Staphylococcus aureus (MIC: 20 µM), Candida albicans (MFC50: 10 µM), Candida albicans (MFC99: 10 µM), Candida albicans (MIC: 20 µM) |
| IC50 value | 0.12 µM | 0.12 µM | 0.12 µM | 0.26 µM | 0.20 µM | 0.22 µM | 0.11 µM | 0.14 µM | 0.12 µM | 0.26 µM | 0.10 µM | 1.32 µM | 17.05 µg/ml | 4.81 µg/ml | 5.99 µg/ml | 5.08 µg/ml | 6.07 µg/ml | 0.65 ±0.06 µM | 3.43 ±0.15 µM | 4.81 ±0.48 µM |
| Sequence | GIPCGESCVWIPCISSAIGCSCKSKVCYRN |
| Sequence Length | 30 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 3164.75 |
| Monoisotopic Molecular Weight (Da) | 3162.43 |
| Isoelectric Point (pI) | 8.33 |
| Method / Extraction | MS |
