PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2226	Cycloviolacin-O2	"12477048, 6872274, 20580652, 21723349, 28669767"	"Viola odorata, Viola biflora"	Violaceae	Cyclotide	"Antibacterial, Anticancer, Antifungal, Cytotoxic, Nematocide, Membrane-Binding, Hemolytic, Anti-barnacle, Antiparasitic, Antimicrobial"	"Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization ; Cycloviolacin O2 shown to possess cytotoxic activity in cancer cells and have specific membrane-disrupting activity; Cycloviolacin O2 exhibited strong cytotoxic activities; Cycloviolacin O2 affect the motility; Disruption of cell membranes plays a crucial role in the cytotoxic effect of the cyclotide cycloviolacin O2; Shown to possess hemolytic activity; Shown to possess anti-barnacle activity; Target site: lipid bilayer; Human lymphocytes(IC50: 0.87 µM); 50% Hemolysis against Human erythrocytes at 36 µM; Human foreskin fibroblasts HFF-1(IC50: 1.29 ±0.07 µM)"	"Human Myeloma cells RPMI-8226/s (IC50: 0.12 µM), Human Myeloma cells RPMI-8226/Dox40 (IC50: 0.12 µM), Human Myeloma cells RPMI-8226/LR-5 (IC50: 0.12 µM), Human histiocytic lymphoma U-937/GTB (IC50: 0.26 µM), Human histiocytic lymphoma U-937-Vcr (IC50: 0.20 µM), Human renal adenocarcinoma ACHN (IC50: 0.22 µM), Human lymphoblastic leukemia CCRF-CEM (IC50: 0.11 µM), Human lymphoblastic leukemia CCRF-CEM/VM-1 (IC50: 0.14 µM), Human lung carcinoma NCI-H69 (IC50: 0.12 µM), Human lung carcinoma NCI-H69AR (IC50: 0.26 µM), Chronic lymphocytic leukemia (IC50: 0.10 µM), Ovarian carcinoma (IC50: 1.32 µM), Human glioblastoma U251-MG (IC50: 17.05 µg/ml), Human breast adenocarcinoma MDA-MB-231 (IC50: 4.81 µg/ml), Human lung carcinoma A549 (IC50: 5.99 µg/ml), Human prostate cancer DU145 (IC50: 5.08 µg/ml), Human hepatocarcinoma BEL-7402 (IC50: 6.07 µg/ml), Human skin melanoma MM96L (IC50: 0.65 ±0.06 µM), Human cervical carcinoma HeLa (IC50: 3.43 ±0.15 µM), Human gastric cancer BGC-823 (IC50: 4.81 ±0.48 µM), Escherichia coli (MBC50: 5 µM), Escherichia coli (MBC99: 10 µM), Escherichia coli (MIC: 20 µM), Escherichia coli (MIC: 160 µM), Escherichia coli (MIC: 160 µM), Escherichia coli (MIC: 80 µM), Pseudomonas aeruginosa (MBC50: 5 µM), Pseudomonas aeruginosa (MBC99: 5 µM), Pseudomonas aeruginosa (MIC: 10 µM), Pseudomonas aeruginosa (MIC: 80 µM), Pseudomonas aeruginosa (MIC: 160 µM), Staphylococcus aureus (MBC50: 10 µM), Staphylococcus aureus (MBC99: 20 µM), Staphylococcus aureus (MIC: 20 µM), Candida albicans (MFC50: 10 µM), Candida albicans (MFC99: 10 µM), Candida albicans (MIC: 20 µM)"	GIPCGESCVWIPCISSAIGCSCKSKVCYRN	30	"Experimental evidence at protein level"	3164.75	3162.43	8.33	MS	"Synthesis Type : Ribosomal; cross link- SWISS P58434, CAMP2701, PHYT00171"