Detailed Peptide Information
This page shows detailed information of individual peptides present in PlantPepDB database. The page is majorly divided into 3 sections. The first sections contains primary information like peptide activity, source, sequence, etc. In the secondary information section user can access the tertiary structure as well as the physico-chemical properties by clicking the respective links. Further there is also link of the source database and research article from which the peptide data is retrieved. Download the information by clicking
| Primary Information |
|---|
| PPepDB ID | PPepDB_2223 |
| Peptide Name | Plant defensin VrD1 |
| PMID(s) | 15080630, 16544327, 12452641 |
| Plant Source (Scientific Name) | Vigna radiata, Vigna nakashimae |
| Plant Source (Common Name) | Mung bean |
| Plant Family | Fabaceae |
| Peptide Family | Defensin |
| Peptide Function | Antimicrobial, Antibacterial, Antifungal, Insecticidal, Alpha-amylase-inhibitor |
| Peptide Function Description | is active against larvae of the bruchid Callosobruchus chinensis.; Inhibits development of seed beetles (Bruchinae) larva; Target site- Lipid Bilayer |
| Activity Against | Escherichia coli, Vibrio harveyi, Vibrio alginolyticus, Fusarium oxysporum(IC50: 5.4 µg/ml), Fusarium oxysporum (IC50: 17.5 µg/ml), Fusarium oxysporum f. sp. Pisi(IC50: 12.1 µg/ml), Pyricularia oryzae(IC50: 20.7 µg/ml), Rhizoctonia solani(IC50: 90.7 µg/ml), Trichophyton rubrum(IC50: 63.8 µg/ml) |
| IC50 value | 5.4 µg/ml | 17.5 µg/ml | 12.1 µg/ml | 20.7 µg/ml | 90.7 µg/ml | 63.8 µg/ml |
| Sequence | RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC |
| Sequence Length | 46 |
| Validation | Experimental evidence at protein level |
| Average Molecular Weight (Da) | 5122.09 |
| Monoisotopic Molecular Weight (Da) | 5118.33 |
| Isoelectric Point (pI) | 9.06 |
| Method / Extraction | NMR |
| External links (Uniprot, PDB and Source Information Database) |
|---|
| Uniprot | Q6T418, A9UKM6 |
| NCBI | 159163059 |
| EMBL | --NA-- |
| Link to Source Databases | DBAASP_4352, PhytAMP_PHYT00055, EROP-Moscow_09181, EROP-Moscow_06935, DEFENSINS-Knowledgebase_256, CAMPSQ1491, APD_00716 |
|---|
| Addtional Information | Synthesis Type: Ribosomal; E. coli TOP10'F- Escherichia coli; First reported plant defensin exhibiting insecticidal activity; It is also insecticidal. The peptide inhibits alpha-amylase, required for the digestion of plants in the insect gut. Structure reported by Liu et al (2006) Proteins 63: 777-786. You can rotate, zoom, and view the 3D structure here in the PDB . 11/24/09; 2/2014. |
