PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2223	"Plant defensin VrD1"	"15080630, 16544327, 12452641"	"Vigna radiata, Vigna nakashimae"	Fabaceae	Defensin	"Antimicrobial, Antibacterial, Antifungal, Insecticidal, Alpha-amylase-inhibitor"	"is active against larvae of the bruchid Callosobruchus chinensis.; Inhibits development of seed beetles (Bruchinae) larva; Target site- Lipid Bilayer"	"Escherichia coli, Vibrio harveyi, Vibrio alginolyticus, Fusarium oxysporum(IC50: 5.4 µg/ml), Fusarium oxysporum (IC50: 17.5 µg/ml), Fusarium oxysporum f. sp. Pisi(IC50: 12.1 µg/ml), Pyricularia oryzae(IC50: 20.7 µg/ml), Rhizoctonia solani(IC50: 90.7 µg/ml), Trichophyton rubrum(IC50: 63.8 µg/ml)"	RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC	46	"Experimental evidence at protein level"	5122.09	5118.33	9.06	NMR	"Synthesis Type: Ribosomal; E. coli TOP10'F- Escherichia coli; First reported plant defensin exhibiting insecticidal activity; It is also insecticidal. The peptide inhibits alpha-amylase, required for the digestion of plants in the insect gut. Structure reported by Liu et al (2006) Proteins 63: 777-786. You can rotate, zoom, and view the 3D structure here in the PDB . 11/24/09; 2/2014."